PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 791aa    MW: 88791 Da    PI: 4.6754
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09435.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.93.1e-10640681346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW++ + el+++av+q G++ ++ I + ++ +Rt++q+k+++ k
        PK09435.1 640 RWSKNDTELFYEAVRQIGTD-FTIIQQLFP-NRTREQVKLKFKK 681
                      9*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159638.4E-29631714No hitNo description
PROSITE profilePS512939.449636684IPR017884SANT domain
SMARTSM007176.0E-8637685IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-5639681IPR009057Homeodomain-like
SuperFamilySSF466894.11E-10639687IPR009057Homeodomain-like
CDDcd001675.45E-6640681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 791 aa     Download sequence    Send to blast
XPKPNPLGDR RPKPKPKPNL HCRRFGGPAF RFTPIEVTMQ LDVDPLDDLL SETKTNNSHK  60
FRPKMKAQPR KGGTRGVASD LPNLMDRPVL CSIEEDPLQS AVQDSLQSVE SLGVTGKSHD  120
TNPLHSEDVV PDGNRDWQSN LGRSLGENAD IFSGLECLDD FILKLQAIPG SEASKSQSKV  180
HTDKQQSDKF LTSYGVNSNM EGPISTSHME TGSEENLSVP AHSSYDSSSF TICDVAPSQI  240
SSDYHSTQDP LSLSNTAVSD EQEEAQINDG RSKTMGAEDL FDFEMYEGTV VSGQRVGKFQ  300
PKPKLGKGKK KPSTSEPQAE VRSGVPLPAV HTVPLDQGYG QESSMLEFPS EGILDYSSVR  360
FDDSISLDPI SDIQGDTEPT NLAKATHSEV VEDDPVVEEV DGKSKIGESS TEPNDLRRSK  420
RSSASMQDIE GRKSSKQQQE DLGQLSDDPV GEVHDISGSV CDPPSTSNRD EGDNDEEFRV  480
ENTSKKKKAT RKVKEPVSGK EKPVRKRKSS KQASEEKTEE PPKKFSHSTR RKKRIVDQAL  540
LDMPEDEIDP QRLPIKDLIL LAEHRERMAI KDAAKLKTEQ TNQSTEDNFR EDVSHNEEMF  600
HSEQGEQGQN SDDNQPTYRA QPSSTYVNYH SFMDRTPSTR WSKNDTELFY EAVRQIGTDF  660
TIIQQLFPNR TREQVKLKFK KEERQHPLRL SDALTNRTKD HSHFESVIKQ LQELTAQAKQ  720
DANANESNWY PGDEEVEEPT HNANEEHAKS ELDEVVKDQE REPEVTDVQN SPLKYDEGDD  780
DPDMWNNYDD Y
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1485507KKKATRKVKEPVSGKEKPVRKRK
2501507KPVRKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010105352.10.0Transcription factor TFIIIB component B''
TrEMBLW9RZ720.0W9RZ72_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.15e-46MYB_related family protein